Lineage for d1uita_ (1uit A:)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 373409Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 373410Superfamily b.36.1: PDZ domain-like [50156] (4 families) (S)
    peptide-binding domain
  5. 373411Family b.36.1.1: PDZ domain [50157] (24 proteins)
  6. 373416Protein Discs large 5 protein KIAA0583 [101725] (1 species)
  7. 373417Species Human (Homo sapiens) [TaxId:9606] [101726] (1 PDB entry)
  8. 373418Domain d1uita_: 1uit A: [99433]
    structural genomics; Rsgi Ruh-006 domain

Details for d1uita_

PDB Entry: 1uit (more details)

PDB Description: Solution structure of RSGI RUH-006, The third PDZ domain OF hDlg5 (KIAA0583) protein [Homo sapiens]

SCOP Domain Sequences for d1uita_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uita_ b.36.1.1 (A:) Discs large 5 protein KIAA0583 {Human (Homo sapiens)}
gssgssggerrkdrpyveeprhvkvqkgseplgisivsgekggiyvskvtvgsiahqagl
eygdqllefnginlrsateqqarliigqqcdtitilaqynphvhqlsshsrsgpssg

SCOP Domain Coordinates for d1uita_:

Click to download the PDB-style file with coordinates for d1uita_.
(The format of our PDB-style files is described here.)

Timeline for d1uita_: