SCOP 1.67: Domain d1uisb_: 1uis B:

Lineage for d1uisb_ (1uis B:)

1. Root: SCOP 1.67

2. Class d: Alpha and beta proteins (a+b) [53931] (260 folds)

3. Fold d.22: GFP-like [54510] (1 superfamily)
   beta-sheet folds into a barrel (n=11, S=14) around the central helix

4. Superfamily d.22.1: GFP-like [54511] (2 families)

5. Family d.22.1.1: Fluorescent proteins [54512] (4 proteins)

6. Protein Red fluorescent protein fp61 [102854] (1 species)

7. Species Sea anemone (Entacmaea quadricolor) [TaxId:6118] [102855] (1 PDB entry)

8. Domain d1uisb_: 1uis B: [99432]
   complexed with acy, ca, nrq

Details for d1uisb_

PDB Entry: 1uis, 2 Å

PDB Description: The 2.0 crystal structure of eqFP611, a far-red fluorescent protein from the sea anemone Entacmaea quadricolor

SCOP Domain Sequences for d1uisb_:

Sequence; same for both SEQRES and ATOM records:

>d1uisb_ d.22.1.1 (B:) Red fluorescent protein fp61 {Sea anemone (Entacmaea quadricolor)}
ihmnslikenmrmmvvmegsvngyqfkctgegdgnpymgtqtmrikvveggplpfafdil
atsfmsktfikhtkgipdffkqsfpegftwervtryedggvftvmqdtsledgclvyhak
vtgvnfpsngavmqkktkgwepntemlypadgglrgysqmalnvdgggylscsfettyrs
kktvenfkmpgfhfvdhrlerleesdkemfvvqhehavakfcdlp

Timeline for d1uisb_:

• d1uisb_ is new in SCOP 1.67
  
• d1uisb_ appears in SCOP 1.69
  
• d1uisb_ appears in the current release, SCOPe 2.08, called d1uisb1