Lineage for d1uisb1 (1uis B:1-225)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2939772Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 2939773Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 2939774Family d.22.1.1: Fluorescent proteins [54512] (6 proteins)
  6. 2940222Protein Red fluorescent protein fp61 [102854] (1 species)
  7. 2940223Species Sea anemone (Entacmaea quadricolor) [TaxId:6118] [102855] (1 PDB entry)
  8. 2940225Domain d1uisb1: 1uis B:1-225 [99432]
    Other proteins in same PDB: d1uisa2, d1uisb2
    complexed with acy, ca

Details for d1uisb1

PDB Entry: 1uis (more details), 2 Å

PDB Description: The 2.0 crystal structure of eqFP611, a far-red fluorescent protein from the sea anemone Entacmaea quadricolor
PDB Compounds: (B:) red fluorescent protein FP611

SCOPe Domain Sequences for d1uisb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uisb1 d.22.1.1 (B:1-225) Red fluorescent protein fp61 {Sea anemone (Entacmaea quadricolor) [TaxId: 6118]}
mnslikenmrmmvvmegsvngyqfkctgegdgnpymgtqtmrikvveggplpfafdilat
sfmygsktfikhtkgipdffkqsfpegftwervtryedggvftvmqdtsledgclvyhak
vtgvnfpsngavmqkktkgwepntemlypadgglrgysqmalnvdgggylscsfettyrs
kktvenfkmpgfhfvdhrlerleesdkemfvvqhehavakfcdlp

SCOPe Domain Coordinates for d1uisb1:

Click to download the PDB-style file with coordinates for d1uisb1.
(The format of our PDB-style files is described here.)

Timeline for d1uisb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1uisb2