SCOPe 2.07: Domain d1uisa1: 1uis A:1-225

Lineage for d1uisa1 (1uis A:1-225)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.22: GFP-like [54510] (1 superfamily)
   beta-sheet folds into a barrel (n=11, S=14) around the central helix

4. Superfamily d.22.1: GFP-like [54511] (3 families)

5. Family d.22.1.1: Fluorescent proteins [54512] (6 proteins)

6. Protein Red fluorescent protein fp61 [102854] (1 species)

7. Species Sea anemone (Entacmaea quadricolor) [TaxId:6118] [102855] (1 PDB entry)

8. Domain d1uisa1: 1uis A:1-225 [99431]
   Other proteins in same PDB: d1uisa2, d1uisb2
   complexed with acy, ca

Details for d1uisa1

PDB Entry: 1uis, 2 Å

PDB Description: The 2.0 crystal structure of eqFP611, a far-red fluorescent protein from the sea anemone Entacmaea quadricolor

PDB Compounds: (A:) red fluorescent protein FP611

SCOPe Domain Sequences for d1uisa1:

Sequence; same for both SEQRES and ATOM records:

>d1uisa1 d.22.1.1 (A:1-225) Red fluorescent protein fp61 {Sea anemone (Entacmaea quadricolor) [TaxId: 6118]}
mnslikenmrmmvvmegsvngyqfkctgegdgnpymgtqtmrikvveggplpfafdilat
sfmygsktfikhtkgipdffkqsfpegftwervtryedggvftvmqdtsledgclvyhak
vtgvnfpsngavmqkktkgwepntemlypadgglrgysqmalnvdgggylscsfettyrs
kktvenfkmpgfhfvdhrlerleesdkemfvvqhehavakfcdlp

Timeline for d1uisa1:

• d1uisa1 first appeared in SCOP 1.67, called d1uisa_
  
• d1uisa1 appears in SCOPe 2.06
  
• d1uisa1 appears in the current release, SCOPe 2.08