Lineage for d1uira_ (1uir A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2129295Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2129296Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2129722Family c.66.1.17: Spermidine synthase [69557] (3 protein domains)
    contains additional N-terminal tetramerisation all-beta domain, res. 1-71
  6. 2129727Protein Spermidine synthase [69558] (6 species)
    polyamine aminopropyltransferase
  7. 2129764Species Thermus thermophilus [TaxId:274] [102586] (1 PDB entry)
  8. 2129765Domain d1uira_: 1uir A: [99429]

Details for d1uira_

PDB Entry: 1uir (more details), 2 Å

PDB Description: Crystal Structure of Polyamine Aminopropyltransfease from Thermus thermophilus
PDB Compounds: (A:) Polyamine Aminopropyltransferase

SCOPe Domain Sequences for d1uira_:

Sequence, based on SEQRES records: (download)

>d1uira_ c.66.1.17 (A:) Spermidine synthase {Thermus thermophilus [TaxId: 274]}
mdygmyffehvtpyetlvrrmerviasgktpfqdyflfeskgfgkvlildkdvqsterde
yiyhetlvhpamlthpepkrvlivgggegatlrevlkhptvekavmvdidgelvevakrh
mpewhqgafddpravlviddaraylerteerydvviidltdpvgednparllytvefyrl
vkahlnpggvmgmqtgmillthhrvhpvvhrtvreafryvrsyknhipgfflnfgfllas
dafdpaafsegviearirernlalrhltapyleamfvlpkdllealeketmvstdqnpfy
vtpegearqapy

Sequence, based on observed residues (ATOM records): (download)

>d1uira_ c.66.1.17 (A:) Spermidine synthase {Thermus thermophilus [TaxId: 274]}
mdygmyffehvtpyetlvrrmerviasgktpfqdyflfeskgfgkvlildkdvqsterde
yiyhetlvhpamlthpepkrvlivgggegatlrevlkhptvekavmvdidgelvevakrh
mpewhqgafddpravlviddaraylerteerydvviidltdpvgednparllytvefyrl
vkahlnpggvmgmqtgmillrvhpvvhrtvreafryvrsyknhipgfflnfgfllasdaf
dpaafsegviearirernlalrhltapyleamfvlpkdllealeketmvstdqnpfyvtp
egearqapy

SCOPe Domain Coordinates for d1uira_:

Click to download the PDB-style file with coordinates for d1uira_.
(The format of our PDB-style files is described here.)

Timeline for d1uira_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1uirb_