Lineage for d1uinb_ (1uin B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2139769Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214
  4. 2139770Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families) (S)
  5. 2139771Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (9 protein domains)
  6. 2139913Protein Threonine synthase [64172] (4 species)
  7. 2139930Species Thermus thermophilus [TaxId:274] [102667] (6 PDB entries)
  8. 2139946Domain d1uinb_: 1uin B: [99428]
    complexed with plp, so4

Details for d1uinb_

PDB Entry: 1uin (more details), 2.25 Å

PDB Description: Crystal Structure of Threonine Synthase from Thermus Thermophilus HB8, Trigonal Crystal Form
PDB Compounds: (B:) threonine synthase

SCOPe Domain Sequences for d1uinb_:

Sequence, based on SEQRES records: (download)

>d1uinb_ c.79.1.1 (B:) Threonine synthase {Thermus thermophilus [TaxId: 274]}
plieryrnllpvsektpvisllegstpliplkgpeearkkgirlyakyeglnptgsfkdr
gmtlavskaveggaqavacastgntaasaaayaaragilaivvlpagyvalgkvaqslvh
garivqvegnfddalrltqklteafpvalvnsvnphrlegqktlafevvdelgdaphyha
lpvgnagnitahwmgykayhalgkakrlprmlgfqaagaaplvlgrpverpetlatairi
gnpaswqgavrakeesggvieavtdeeilfayrylareegifcepasaaamagvfkllre
grlepestvvltltghglkdpataervaelpppvparleavaaaagl

Sequence, based on observed residues (ATOM records): (download)

>d1uinb_ c.79.1.1 (B:) Threonine synthase {Thermus thermophilus [TaxId: 274]}
plieryrnllpvsektpvisllegstpliplkgpeearkkgirlyakyeglnptgsfkdr
gmtlavskaveggaqavacastgntaasaaayaaragilaivvlpagvalgkvaqslvhg
arivqvegnfddalrltqklteafpvalvnsvnphrlegqktlafevvdelgdaphyhal
pvgnagnitahwmgykayhalgkakrlprmlgfqaagaaplvlgrpverpetlatairig
npaswqgavrakeesggvieavtdeeilfayrylareegifcepasaaamagvfkllreg
rlepestvvltltghglkdpataervaelpppvparleavaaaagl

SCOPe Domain Coordinates for d1uinb_:

Click to download the PDB-style file with coordinates for d1uinb_.
(The format of our PDB-style files is described here.)

Timeline for d1uinb_: