![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214 |
![]() | Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families) ![]() |
![]() | Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (9 proteins) |
![]() | Protein Threonine synthase [64172] (4 species) |
![]() | Species Thermus thermophilus [TaxId:274] [102667] (5 PDB entries) |
![]() | Domain d1uina_: 1uin A: [99427] complexed with plp, so4 |
PDB Entry: 1uin (more details), 2.25 Å
SCOPe Domain Sequences for d1uina_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1uina_ c.79.1.1 (A:) Threonine synthase {Thermus thermophilus [TaxId: 274]} rpplieryrnllpvsektpvisllegstpliplkgpeearkkgirlyakyeglnptgsfk drgmtlavskaveggaqavacastgntaasaaayaaragilaivvlpagyvalgkvaqsl vhgarivqvegnfddalrltqklteafpvalvnsvnphrlegqktlafevvdelgdaphy halpvgnagnitahwmgykayhalgkakrlprmlgfqaagaaplvlgrpverpetlatai rignpaswqgavrakeesggvieavtdeeilfayrylareegifcepasaaamagvfkll regrlepestvvltltghglkdpataervaelpppvparleavaaaagll
Timeline for d1uina_: