Lineage for d1ui8b3 (1ui8 B:97-211)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 408884Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 408949Superfamily d.17.2: Amine oxidase N-terminal region [54416] (1 family) (S)
  5. 408950Family d.17.2.1: Amine oxidase N-terminal region [54417] (2 proteins)
    duplication: contains two domains of this fold
  6. 408951Protein Copper amine oxidase, domains 1 and 2 [54418] (4 species)
  7. 408952Species Arthrobacter globiformis [TaxId:1665] [54421] (12 PDB entries)
  8. 408960Domain d1ui8b3: 1ui8 B:97-211 [99424]
    Other proteins in same PDB: d1ui8a1, d1ui8b1
    complexed with cu; mutant

Details for d1ui8b3

PDB Entry: 1ui8 (more details), 1.8 Å

PDB Description: Site-directed mutagenesis of His592 involved in binding of copper ion in Arthrobacter globiformis amine oxidase

SCOP Domain Sequences for d1ui8b3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ui8b3 d.17.2.1 (B:97-211) Copper amine oxidase, domains 1 and 2 {Arthrobacter globiformis}
elpvleeefevveqllatderwlkalaarnldvskvrvaplsagvfeyaeergrrilrgl
afvqdfpedsawahpvdglvayvdvvskevtrvidtgvfpvpaehgnytdpeltg

SCOP Domain Coordinates for d1ui8b3:

Click to download the PDB-style file with coordinates for d1ui8b3.
(The format of our PDB-style files is described here.)

Timeline for d1ui8b3: