Lineage for d1ui8b2 (1ui8 B:9-96)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 599696Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 599780Superfamily d.17.2: Amine oxidase N-terminal region [54416] (1 family) (S)
  5. 599781Family d.17.2.1: Amine oxidase N-terminal region [54417] (2 proteins)
    duplication: contains two domains of this fold
  6. 599782Protein Copper amine oxidase, domains 1 and 2 [54418] (4 species)
  7. 599783Species Arthrobacter globiformis [TaxId:1665] [54421] (15 PDB entries)
  8. 599796Domain d1ui8b2: 1ui8 B:9-96 [99423]
    Other proteins in same PDB: d1ui8a1, d1ui8b1

Details for d1ui8b2

PDB Entry: 1ui8 (more details), 1.8 Å

PDB Description: site-directed mutagenesis of his592 involved in binding of copper ion in arthrobacter globiformis amine oxidase

SCOP Domain Sequences for d1ui8b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ui8b2 d.17.2.1 (B:9-96) Copper amine oxidase, domains 1 and 2 {Arthrobacter globiformis}
aspfrlasageisevqgilrtagllgpekriaylgvldpargagseaedrrfrvfihdvs
garpqevtvsvtngtvisaveldtaatg

SCOP Domain Coordinates for d1ui8b2:

Click to download the PDB-style file with coordinates for d1ui8b2.
(The format of our PDB-style files is described here.)

Timeline for d1ui8b2: