Lineage for d1ui8b1 (1ui8 B:212-628)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 372004Fold b.30: Supersandwich [49993] (3 superfamilies)
    sandwich; 18 strands in 2 sheets
  4. 372005Superfamily b.30.2: Amine oxidase catalytic domain [49998] (1 family) (S)
  5. 372006Family b.30.2.1: Amine oxidase catalytic domain [49999] (2 proteins)
  6. 372007Protein Copper amine oxidase, domain 3 [50000] (4 species)
  7. 372008Species Arthrobacter globiformis [TaxId:1665] [50003] (12 PDB entries)
  8. 372012Domain d1ui8b1: 1ui8 B:212-628 [99422]
    Other proteins in same PDB: d1ui8a2, d1ui8a3, d1ui8b2, d1ui8b3
    complexed with cu; mutant

Details for d1ui8b1

PDB Entry: 1ui8 (more details), 1.8 Å

PDB Description: Site-directed mutagenesis of His592 involved in binding of copper ion in Arthrobacter globiformis amine oxidase

SCOP Domain Sequences for d1ui8b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ui8b1 b.30.2.1 (B:212-628) Copper amine oxidase, domain 3 {Arthrobacter globiformis}
plrttqkpisitqpegpsftvtggnhiewekwsldvgfdvregvvlhniafrdgdrlrpi
inrasiaemvvpygdpspirswqnyfdtgeylvgqyanslelgcdclgditylspvisda
fgnpreirngicmheedwgilakhsdlwsginytrrnrrmvisffttignadygfywyly
ldgtiefeakatgvvftsafpeggsdnisqlapglgapfhqhifsarldmaidgftnrve
eedvvrqtmgpgnergnafsrkrtvltreseavreadartgrtwiisnpesknrlnepvg
yklhahnqptlladpgssiarraafatkdlwvtryadderyptgdfvnqhsggaglpsyi
aqdrdidgqdivvwhtfgltafprvedwpimpvdtvgfklrpegffdrspvldvpan

SCOP Domain Coordinates for d1ui8b1:

Click to download the PDB-style file with coordinates for d1ui8b1.
(The format of our PDB-style files is described here.)

Timeline for d1ui8b1: