SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1ui8a1 (1ui8 A:212-628)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2044543Fold b.30: Supersandwich [49993] (3 superfamilies)
    sandwich; 18 strands in 2 sheets
  4. 2044544Superfamily b.30.2: Amine oxidase catalytic domain [49998] (1 family) (S)
    automatically mapped to Pfam PF01179
  5. 2044545Family b.30.2.1: Amine oxidase catalytic domain [49999] (2 protein domains)
  6. 2044546Protein Copper amine oxidase, domain 3 [50000] (4 species)
  7. 2044547Species Arthrobacter globiformis [TaxId:1665] [50003] (40 PDB entries)
    Uniprot P46881 9-628
  8. 2044583Domain d1ui8a1: 1ui8 A:212-628 [99419]
    Other proteins in same PDB: d1ui8a2, d1ui8a3, d1ui8b2, d1ui8b3
    complexed with cu

Details for d1ui8a1

PDB Entry: 1ui8 (more details), 1.8 Å

PDB Description: Site-directed mutagenesis of His592 involved in binding of copper ion in Arthrobacter globiformis amine oxidase
PDB Compounds: (A:) phenylethylamine oxidase

SCOPe Domain Sequences for d1ui8a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ui8a1 b.30.2.1 (A:212-628) Copper amine oxidase, domain 3 {Arthrobacter globiformis [TaxId: 1665]}
plrttqkpisitqpegpsftvtggnhiewekwsldvgfdvregvvlhniafrdgdrlrpi
inrasiaemvvpygdpspirswqnyfdtgeylvgqyanslelgcdclgditylspvisda
fgnpreirngicmheedwgilakhsdlwsginytrrnrrmvisffttignydygfywyly
ldgtiefeakatgvvftsafpeggsdnisqlapglgapfhqhifsarldmaidgftnrve
eedvvrqtmgpgnergnafsrkrtvltreseavreadartgrtwiisnpesknrlnepvg
yklhahnqptlladpgssiarraafatkdlwvtryadderyptgdfvnqhsggaglpsyi
aqdrdidgqdivvwhtfgltafprvedwpimpvdtvgfklrpegffdrspvldvpan

SCOPe Domain Coordinates for d1ui8a1:

Click to download the PDB-style file with coordinates for d1ui8a1.
(The format of our PDB-style files is described here.)

Timeline for d1ui8a1: