SCOPe 2.03: Domain d1ui7a3: 1ui7 A:97-211

Lineage for d1ui7a3 (1ui7 A:97-211)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.2: Amine oxidase N-terminal region [54416] (1 family)

5. Family d.17.2.1: Amine oxidase N-terminal region [54417] (2 proteins)
   duplication: contains two domains of this fold

6. Protein Copper amine oxidase, domains 1 and 2 [54418] (4 species)

7. Species Arthrobacter globiformis [TaxId:1665] [54421] (40 PDB entries)
   Uniprot P46881 9-628

8. Domain d1ui7a3: 1ui7 A:97-211 [99415]
   Other proteins in same PDB: d1ui7a1, d1ui7b1
   complexed with cu

Details for d1ui7a3

PDB Entry: 1ui7, 2 Å

PDB Description: site-directed mutagenesis of his433 involved in binding of copper ion in arthrobacter globiformis amine oxidase

PDB Compounds: (A:) phenylethylamine oxidase

SCOPe Domain Sequences for d1ui7a3:

Sequence; same for both SEQRES and ATOM records:

>d1ui7a3 d.17.2.1 (A:97-211) Copper amine oxidase, domains 1 and 2 {Arthrobacter globiformis [TaxId: 1665]}
elpvleeefevveqllatderwlkalaarnldvskvrvaplsagvfeyaeergrrilrgl
afvqdfpedsawahpvdglvayvdvvskevtrvidtgvfpvpaehgnytdpeltg

Timeline for d1ui7a3:

• d1ui7a3 first appeared in SCOP 1.67
  
• d1ui7a3 appears in SCOPe 2.02
  
• d1ui7a3 appears in SCOPe 2.04
  
• d1ui7a3 appears in the current release, SCOPe 2.08