Lineage for d1ui1a_ (1ui1 A:)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 825199Fold c.18: Uracil-DNA glycosylase-like [52140] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134
  4. 825200Superfamily c.18.1: Uracil-DNA glycosylase-like [52141] (4 families) (S)
  5. 825249Family c.18.1.2: Mug-like [52147] (3 proteins)
  6. 825261Protein Thermophilic uracil-DNA glycosylase [89577] (2 species)
  7. 825265Species Thermus thermophilus [TaxId:274] [102213] (2 PDB entries)
  8. 825267Domain d1ui1a_: 1ui1 A: [99412]
    complexed with fs4

Details for d1ui1a_

PDB Entry: 1ui1 (more details), 2.8 Å

PDB Description: crystal structure of uracil-dna glycosylase from thermus thermophilus hb8
PDB Compounds: (A:) uracil-DNA glycosylase

SCOP Domain Sequences for d1ui1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ui1a_ c.18.1.2 (A:) Thermophilic uracil-DNA glycosylase {Thermus thermophilus [TaxId: 274]}
tlellqaqaqnctacrlmegrtrvvfgegnpdaklmivgegpgeeedktgrpfvgkagql
lnrileaagipreevyitnivkcrppqnraplpdeakictdkwllkqieliapqiivplg
avaaefflgekvsitkvrgkwyewhgikvfpmfhpayllrnpsrapgspkhltwldiqev
kraldalp

SCOP Domain Coordinates for d1ui1a_:

Click to download the PDB-style file with coordinates for d1ui1a_.
(The format of our PDB-style files is described here.)

Timeline for d1ui1a_: