SCOP 1.67: Domain d1ui1a_: 1ui1 A:

Lineage for d1ui1a_ (1ui1 A:)

1. Root: SCOP 1.67

2. Class c: Alpha and beta proteins (a/b) [51349] (130 folds)

3. Fold c.18: DNA glycosylase [52140] (1 superfamily)
   3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.18.1: DNA glycosylase [52141] (3 families)

5. Family c.18.1.2: Mug-like [52147] (2 proteins)

6. Protein Thermophilic uracil-DNA glycosylase [89577] (2 species)

7. Species Thermus thermophilus [TaxId:274] [102213] (2 PDB entries)

8. Domain d1ui1a_: 1ui1 A: [99412]
   complexed with fs4

Details for d1ui1a_

PDB Entry: 1ui1, 2.8 Å

PDB Description: crystal structure of uracil-dna glycosylase from thermus thermophilus hb8

SCOP Domain Sequences for d1ui1a_:

Sequence; same for both SEQRES and ATOM records:

>d1ui1a_ c.18.1.2 (A:) Thermophilic uracil-DNA glycosylase {Thermus thermophilus}
tlellqaqaqnctacrlmegrtrvvfgegnpdaklmivgegpgeeedktgrpfvgkagql
lnrileaagipreevyitnivkcrppqnraplpdeakictdkwllkqieliapqiivplg
avaaefflgekvsitkvrgkwyewhgikvfpmfhpayllrnpsrapgspkhltwldiqev
kraldalp

Timeline for d1ui1a_:

• d1ui1a_ is new in SCOP 1.67
  
• d1ui1a_ appears in SCOP 1.69
  
• d1ui1a_ appears in the current release, SCOPe 2.08