Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.18: Uracil-DNA glycosylase-like [52140] (1 superfamily) 3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134 |
Superfamily c.18.1: Uracil-DNA glycosylase-like [52141] (5 families) |
Family c.18.1.2: Mug-like [52147] (3 proteins) |
Protein Thermophilic uracil-DNA glycosylase [89577] (2 species) |
Species Thermus thermophilus [TaxId:274] [102213] (2 PDB entries) |
Domain d1ui0a_: 1ui0 A: [99411] complexed with sf4, so4, ura |
PDB Entry: 1ui0 (more details), 1.5 Å
SCOPe Domain Sequences for d1ui0a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ui0a_ c.18.1.2 (A:) Thermophilic uracil-DNA glycosylase {Thermus thermophilus [TaxId: 274]} tlellqaqaqnctacrlmegrtrvvfgegnpdaklmivgegpgeeedktgrpfvgkagql lnrileaagipreevyitnivkcrppqnraplpdeakictdkwllkqieliapqiivplg avaaefflgekvsitkvrgkwyewhgikvfpmfhpayllrnpsrapgspkhltwldiqev kraldalppker
Timeline for d1ui0a_: