Lineage for d1ui0a_ (1ui0 A:)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 390728Fold c.18: DNA glycosylase [52140] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134
  4. 390729Superfamily c.18.1: DNA glycosylase [52141] (3 families) (S)
  5. 390772Family c.18.1.2: Mug-like [52147] (2 proteins)
  6. 390780Protein Thermophilic uracil-DNA glycosylase [89577] (2 species)
  7. 390784Species Thermus thermophilus [TaxId:274] [102213] (2 PDB entries)
  8. 390785Domain d1ui0a_: 1ui0 A: [99411]
    complexed with fs4, so4, ura

Details for d1ui0a_

PDB Entry: 1ui0 (more details), 1.5 Å

PDB Description: crystal structure of uracil-dna glycosylase from thermus thermophilus hb8

SCOP Domain Sequences for d1ui0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ui0a_ c.18.1.2 (A:) Thermophilic uracil-DNA glycosylase {Thermus thermophilus}
tlellqaqaqnctacrlmegrtrvvfgegnpdaklmivgegpgeeedktgrpfvgkagql
lnrileaagipreevyitnivkcrppqnraplpdeakictdkwllkqieliapqiivplg
avaaefflgekvsitkvrgkwyewhgikvfpmfhpayllrnpsrapgspkhltwldiqev
kraldalppker

SCOP Domain Coordinates for d1ui0a_:

Click to download the PDB-style file with coordinates for d1ui0a_.
(The format of our PDB-style files is described here.)

Timeline for d1ui0a_: