SCOPe 2.06: Domain d1uhwa1: 1uhw A:8-103

Lineage for d1uhwa1 (1uhw A:8-103)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.31: DEP domain [63483] (5 proteins)
   membrane-binding domain

6. Protein Pleckstrin [101039] (2 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [101040] (1 PDB entry)

8. Domain d1uhwa1: 1uhw A:8-103 [99410]
   Other proteins in same PDB: d1uhwa2, d1uhwa3

Details for d1uhwa1

PDB Entry: 1uhw

PDB Description: solution structure of the dep domain of mouse pleckstrin

PDB Compounds: (A:) Pleckstrin

SCOPe Domain Sequences for d1uhwa1:

Sequence; same for both SEQRES and ATOM records:

>d1uhwa1 a.4.5.31 (A:8-103) Pleckstrin {Mouse (Mus musculus) [TaxId: 10090]}
lgalylsmkdpekgikelnlekdkkvfnhcltgsgvidwlvsnklvrnrqeglmisasll
segylqpagdlsknaadgiaenpfldspdafyyfpd

Timeline for d1uhwa1:

• d1uhwa1 first appeared in SCOP 1.67, called d1uhwa_
  
• d1uhwa1 was called d1uhwa_ in SCOPe 2.05
  
• d1uhwa1 appears in SCOPe 2.07
  
• d1uhwa1 appears in the current release, SCOPe 2.08