Lineage for d1uhwa_ (1uhw A:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1477565Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1478534Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 1479398Family a.4.5.31: DEP domain [63483] (4 proteins)
    membrane-binding domain
  6. 1479399Protein Pleckstrin [101039] (2 species)
  7. 1479403Species Mouse (Mus musculus) [TaxId:10090] [101040] (1 PDB entry)
  8. 1479404Domain d1uhwa_: 1uhw A: [99410]

Details for d1uhwa_

PDB Entry: 1uhw (more details)

PDB Description: solution structure of the dep domain of mouse pleckstrin
PDB Compounds: (A:) Pleckstrin

SCOPe Domain Sequences for d1uhwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uhwa_ a.4.5.31 (A:) Pleckstrin {Mouse (Mus musculus) [TaxId: 10090]}
gssgssglgalylsmkdpekgikelnlekdkkvfnhcltgsgvidwlvsnklvrnrqegl
misasllsegylqpagdlsknaadgiaenpfldspdafyyfpdsgpssg

SCOPe Domain Coordinates for d1uhwa_:

Click to download the PDB-style file with coordinates for d1uhwa_.
(The format of our PDB-style files is described here.)

Timeline for d1uhwa_: