SCOP 1.73: Domain d1uhwa_: 1uhw A:

Lineage for d1uhwa_ (1uhw A:)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (68 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.31: DEP domain [63483] (4 proteins)
   membrane-binding domain

6. Protein Pleckstrin [101039] (2 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [101040] (1 PDB entry)

8. Domain d1uhwa_: 1uhw A: [99410]

Details for d1uhwa_

PDB Entry: 1uhw

PDB Description: solution structure of the dep domain of mouse pleckstrin

PDB Compounds: (A:) Pleckstrin

SCOP Domain Sequences for d1uhwa_:

Sequence; same for both SEQRES and ATOM records:

>d1uhwa_ a.4.5.31 (A:) Pleckstrin {Mouse (Mus musculus) [TaxId: 10090]}
gssgssglgalylsmkdpekgikelnlekdkkvfnhcltgsgvidwlvsnklvrnrqegl
misasllsegylqpagdlsknaadgiaenpfldspdafyyfpdsgpssg

Timeline for d1uhwa_:

• d1uhwa_ first appeared in SCOP 1.67
  
• d1uhwa_ appears in SCOP 1.71
  
• d1uhwa_ appears in SCOP 1.75
  
• d1uhwa_ appears in the current release, SCOPe 2.08, called d1uhwa1