Lineage for d1uhwa1 (1uhw A:8-103)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2692959Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2693893Family a.4.5.31: DEP domain [63483] (5 proteins)
    membrane-binding domain
  6. 2693894Protein Pleckstrin [101039] (2 species)
  7. 2693898Species Mouse (Mus musculus) [TaxId:10090] [101040] (1 PDB entry)
  8. 2693899Domain d1uhwa1: 1uhw A:8-103 [99410]
    Other proteins in same PDB: d1uhwa2, d1uhwa3

Details for d1uhwa1

PDB Entry: 1uhw (more details)

PDB Description: solution structure of the dep domain of mouse pleckstrin
PDB Compounds: (A:) Pleckstrin

SCOPe Domain Sequences for d1uhwa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uhwa1 a.4.5.31 (A:8-103) Pleckstrin {Mouse (Mus musculus) [TaxId: 10090]}
lgalylsmkdpekgikelnlekdkkvfnhcltgsgvidwlvsnklvrnrqeglmisasll
segylqpagdlsknaadgiaenpfldspdafyyfpd

SCOPe Domain Coordinates for d1uhwa1:

Click to download the PDB-style file with coordinates for d1uhwa1.
(The format of our PDB-style files is described here.)

Timeline for d1uhwa1: