SCOPe 2.02: Domain d1uhvc2: 1uhv C:14-359

Lineage for d1uhvc2 (1uhv C:14-359)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.3: beta-glycanases [51487] (27 proteins)
   consist of a number of sequence families

6. Protein Beta-D-xylosidase, catalytic domain [102077] (2 species)
   glycosyl hydrolase family 39

7. Species Thermoanaerobacterium saccharolyticum [TaxId:28896] [102078] (2 PDB entries)

8. Domain d1uhvc2: 1uhv C:14-359 [99407]
   Other proteins in same PDB: d1uhva1, d1uhvb1, d1uhvc1, d1uhvd1
   complexed with dfx

Details for d1uhvc2

PDB Entry: 1uhv, 2.1 Å

PDB Description: crystal structure of beta-d-xylosidase from thermoanaerobacterium saccharolyticum, a family 39 glycoside hydrolase

PDB Compounds: (C:) beta-xylosidase

SCOPe Domain Sequences for d1uhvc2:

Sequence; same for both SEQRES and ATOM records:

>d1uhvc2 c.1.8.3 (C:14-359) Beta-D-xylosidase, catalytic domain {Thermoanaerobacterium saccharolyticum [TaxId: 28896]}
fsdrwrycvgtgrlglalqkeyietlkyvkenidfkyirghgllcddvgiyredvvgdev
kpfynftyidrifdsfleigirpfveigfmpkklasgtqtvfywegnvtppkdyekwsdl
vkavlhhfisrygieevlkwpfeiwnepnlkefwkdadekeyfklykvtakaikevnenl
kvggpaicggadywiedflnfcyeenvpvdfvsrhaytskqgeytphliyqeimpseyml
nefktvreiiknshfpnlpfhiteyntsyspqnpvhdtpfnaayiarilseggdyvdsfs
ywtfsdvfeerdvprsqfhggfglvalnmipkptfytfkffnamge

Timeline for d1uhvc2:

• d1uhvc2 first appeared in SCOP 1.67
  
• d1uhvc2 appears in SCOPe 2.01
  
• d1uhvc2 appears in SCOPe 2.03
  
• d1uhvc2 appears in the current release, SCOPe 2.08