Lineage for d1uhvb2 (1uhv B:14-359)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2081496Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2082160Family c.1.8.3: beta-glycanases [51487] (27 protein domains)
    consist of a number of sequence families
  6. 2082211Protein Beta-D-xylosidase, catalytic domain [102077] (2 species)
    glycosyl hydrolase family 39
  7. 2082237Species Thermoanaerobacterium saccharolyticum [TaxId:28896] [102078] (2 PDB entries)
  8. 2082239Domain d1uhvb2: 1uhv B:14-359 [99405]
    Other proteins in same PDB: d1uhva1, d1uhvb1, d1uhvc1, d1uhvd1
    complexed with dfx

Details for d1uhvb2

PDB Entry: 1uhv (more details), 2.1 Å

PDB Description: Crystal structure of beta-D-xylosidase from Thermoanaerobacterium saccharolyticum, a family 39 glycoside hydrolase
PDB Compounds: (B:) beta-xylosidase

SCOPe Domain Sequences for d1uhvb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uhvb2 c.1.8.3 (B:14-359) Beta-D-xylosidase, catalytic domain {Thermoanaerobacterium saccharolyticum [TaxId: 28896]}
fsdrwrycvgtgrlglalqkeyietlkyvkenidfkyirghgllcddvgiyredvvgdev
kpfynftyidrifdsfleigirpfveigfmpkklasgtqtvfywegnvtppkdyekwsdl
vkavlhhfisrygieevlkwpfeiwnepnlkefwkdadekeyfklykvtakaikevnenl
kvggpaicggadywiedflnfcyeenvpvdfvsrhaytskqgeytphliyqeimpseyml
nefktvreiiknshfpnlpfhiteyntsyspqnpvhdtpfnaayiarilseggdyvdsfs
ywtfsdvfeerdvprsqfhggfglvalnmipkptfytfkffnamge

SCOPe Domain Coordinates for d1uhvb2:

Click to download the PDB-style file with coordinates for d1uhvb2.
(The format of our PDB-style files is described here.)

Timeline for d1uhvb2: