Lineage for d1uhva2 (1uhv A:14-359)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 681098Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 682152Superfamily c.1.8: (Trans)glycosidases [51445] (14 families) (S)
  5. 682589Family c.1.8.3: beta-glycanases [51487] (24 proteins)
    consist of a number of sequence families
  6. 682641Protein Beta-D-xylosidase, catalytic domain [102077] (2 species)
    glycosyl hydrolase family 39
  7. 682667Species Thermoanaerobacterium saccharolyticum [TaxId:28896] [102078] (2 PDB entries)
  8. 682670Domain d1uhva2: 1uhv A:14-359 [99403]
    Other proteins in same PDB: d1uhva1, d1uhvb1, d1uhvc1, d1uhvd1

Details for d1uhva2

PDB Entry: 1uhv (more details), 2.1 Å

PDB Description: crystal structure of beta-d-xylosidase from thermoanaerobacterium saccharolyticum, a family 39 glycoside hydrolase
PDB Compounds: (A:) beta-xylosidase

SCOP Domain Sequences for d1uhva2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uhva2 c.1.8.3 (A:14-359) Beta-D-xylosidase, catalytic domain {Thermoanaerobacterium saccharolyticum [TaxId: 28896]}
fsdrwrycvgtgrlglalqkeyietlkyvkenidfkyirghgllcddvgiyredvvgdev
kpfynftyidrifdsfleigirpfveigfmpkklasgtqtvfywegnvtppkdyekwsdl
vkavlhhfisrygieevlkwpfeiwnepnlkefwkdadekeyfklykvtakaikevnenl
kvggpaicggadywiedflnfcyeenvpvdfvsrhaytskqgeytphliyqeimpseyml
nefktvreiiknshfpnlpfhiteyntsyspqnpvhdtpfnaayiarilseggdyvdsfs
ywtfsdvfeerdvprsqfhggfglvalnmipkptfytfkffnamge

SCOP Domain Coordinates for d1uhva2:

Click to download the PDB-style file with coordinates for d1uhva2.
(The format of our PDB-style files is described here.)

Timeline for d1uhva2: