| Class b: All beta proteins [48724] (174 folds) |
| Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily) folded sheet; greek-key |
Superfamily b.71.1: Glycosyl hydrolase domain [51011] (5 families) ![]() this domain is C-terminal to the catalytic beta/alpha barrel domain |
| Family b.71.1.2: Composite domain of glycosyl hydrolase families 5, 30, 39 and 51 [89388] (4 proteins) interrupted by the catalytic domain; the C-terminal core is similar to the alpha-amylase domain |
| Protein Beta-D-xylosidase [101926] (2 species) glycosyl hydrolase family 39 |
| Species Thermoanaerobacterium saccharolyticum [TaxId:28896] [101927] (2 PDB entries) |
| Domain d1uhva1: 1uhv A:1-13,A:360-500 [99402] Other proteins in same PDB: d1uhva2, d1uhvb2, d1uhvc2, d1uhvd2 |
PDB Entry: 1uhv (more details), 2.1 Å
SCOP Domain Sequences for d1uhva1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1uhva1 b.71.1.2 (A:1-13,A:360-500) Beta-D-xylosidase {Thermoanaerobacterium saccharolyticum [TaxId: 28896]}
mikvrvpdfsdkkXemlyrdehmlvtrrddgsvaliawnevmdktenpdedyeveipvrf
rdvfikrqlideehgnpwgtwihmgrprypskeqvntlrevakpeimtsqpvandgylnl
kfklgknavvlyelteridesstyiglddskingy
Timeline for d1uhva1: