SCOPe 2.05: Domain d1uhpa_: 1uhp A:

Lineage for d1uhpa_ (1uhp A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.36: PDZ domain-like [50155] (1 superfamily)
   contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix

4. Superfamily b.36.1: PDZ domain-like [50156] (7 families)
   peptide-binding domain

5. Family b.36.1.1: PDZ domain [50157] (47 proteins)
   Pfam PF00595

6. Protein Hypothetical protein KIAA1095 [101723] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [101724] (2 PDB entries)
   Uniprot Q9UPQ7 246-339, 404-512

8. Domain d1uhpa_: 1uhp A: [99400]
   structural genomics; Rsgi Ruh-005 domain

Details for d1uhpa_

PDB Entry: 1uhp

PDB Description: solution structure of rsgi ruh-005, a pdz domain in human cdna, kiaa1095

PDB Compounds: (A:) hypothetical protein KIAA1095

SCOPe Domain Sequences for d1uhpa_:

Sequence; same for both SEQRES and ATOM records:

>d1uhpa_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]}
gssgssgksltlvlhrdsgslgfniiggrpsvdnhdgsssegifvskivdsgpaakeggl
qihdriievngrdlsrathdqaveafktakepivvqvlrrtsgpssg

Timeline for d1uhpa_:

• d1uhpa_ first appeared in SCOP 1.67
  
• d1uhpa_ appears in SCOPe 2.04
  
• d1uhpa_ is called d1uhpa1 in SCOPe 2.06
  
• d1uhpa_ appears in the current release, SCOPe 2.08, called d1uhpa1