Lineage for d1uhpa_ (1uhp A:)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 666573Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 666574Superfamily b.36.1: PDZ domain-like [50156] (4 families) (S)
    peptide-binding domain
  5. 666575Family b.36.1.1: PDZ domain [50157] (46 proteins)
    Pfam PF00595
  6. 666658Protein Hypothetical protein KIAA1095 [101723] (1 species)
  7. 666659Species Human (Homo sapiens) [TaxId:9606] [101724] (2 PDB entries)
  8. 666660Domain d1uhpa_: 1uhp A: [99400]
    structural genomics; Rsgi Ruh-005 domain

Details for d1uhpa_

PDB Entry: 1uhp (more details)

PDB Description: Solution structure of RSGI RUH-005, a PDZ domain in human cDNA, KIAA1095
PDB Compounds: (A:) hypothetical protein KIAA1095

SCOP Domain Sequences for d1uhpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uhpa_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]}
gssgssgksltlvlhrdsgslgfniiggrpsvdnhdgsssegifvskivdsgpaakeggl
qihdriievngrdlsrathdqaveafktakepivvqvlrrtsgpssg

SCOP Domain Coordinates for d1uhpa_:

Click to download the PDB-style file with coordinates for d1uhpa_.
(The format of our PDB-style files is described here.)

Timeline for d1uhpa_: