Lineage for d1uhma_ (1uhm A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2305222Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2306394Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2306714Family a.4.5.13: Linker histone H1/H5 [46827] (4 proteins)
    automatically mapped to Pfam PF00538
  6. 2306715Protein Histone H1 homologue Hho1p [101037] (1 species)
    duplication: contains two similar globular domains
  7. 2306716Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [101038] (4 PDB entries)
  8. 2306720Domain d1uhma_: 1uhm A: [99398]
    N-terminal globular domain, GI

Details for d1uhma_

PDB Entry: 1uhm (more details)

PDB Description: solution structure of the globular domain of linker histone homolog hho1p from s. cerevisiae
PDB Compounds: (A:) Histone H1

SCOPe Domain Sequences for d1uhma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uhma_ a.4.5.13 (A:) Histone H1 homologue Hho1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
eassksyreliiegltalkerkgssrpalkkfikenypivgsasnfdlyfnnaikkgvea
gdfeqpkgpagavklakk

SCOPe Domain Coordinates for d1uhma_:

Click to download the PDB-style file with coordinates for d1uhma_.
(The format of our PDB-style files is described here.)

Timeline for d1uhma_: