![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families) ![]() contains a small beta-sheet (wing) |
![]() | Family a.4.5.13: Linker histone H1/H5 [46827] (4 proteins) automatically mapped to Pfam PF00538 |
![]() | Protein Histone H1 homologue Hho1p [101037] (1 species) duplication: contains two similar globular domains |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [101038] (4 PDB entries) |
![]() | Domain d1uhma_: 1uhm A: [99398] N-terminal globular domain, GI |
PDB Entry: 1uhm (more details)
SCOPe Domain Sequences for d1uhma_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1uhma_ a.4.5.13 (A:) Histone H1 homologue Hho1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} eassksyreliiegltalkerkgssrpalkkfikenypivgsasnfdlyfnnaikkgvea gdfeqpkgpagavklakk
Timeline for d1uhma_: