SCOP 1.69: Domain d1uhma_: 1uhm A:

Lineage for d1uhma_ (1uhm A:)

1. Root: SCOP 1.69

2. Class a: All alpha proteins [46456] (218 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (13 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (55 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.13: Linker histone H1/H5 [46827] (3 proteins)

6. Protein Histone H1 homologue Hho1p [101037] (1 species)
   duplication: contains two similar globular domains

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [101038] (3 PDB entries)

8. Domain d1uhma_: 1uhm A: [99398]
   N-terminal globular domain, GI

Details for d1uhma_

PDB Entry: 1uhm

PDB Description: solution structure of the globular domain of linker histone homolog hho1p from s. cerevisiae

SCOP Domain Sequences for d1uhma_:

Sequence; same for both SEQRES and ATOM records:

>d1uhma_ a.4.5.13 (A:) Histone H1 homologue Hho1p {Baker's yeast (Saccharomyces cerevisiae)}
eassksyreliiegltalkerkgssrpalkkfikenypivgsasnfdlyfnnaikkgvea
gdfeqpkgpagavklakk

Timeline for d1uhma_:

• d1uhma_ first appeared in SCOP 1.67
  
• d1uhma_ appears in SCOP 1.71
  
• d1uhma_ appears in the current release, SCOPe 2.08