Lineage for d1uhca1 (1uhc A:8-73)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2392350Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2392486Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 2392487Family b.34.2.1: SH3-domain [50045] (40 proteins)
  6. 2392737Protein Hypothetical protein Baa76854.1 (KIAA1010) [101671] (1 species)
  7. 2392738Species Human (Homo sapiens) [TaxId:9606] [101672] (2 PDB entries)
  8. 2392739Domain d1uhca1: 1uhc A:8-73 [99397]
    Other proteins in same PDB: d1uhca2, d1uhca3
    structural genomics; C-terminal SH3 domain

Details for d1uhca1

PDB Entry: 1uhc (more details)

PDB Description: solution structure of rsgi ruh-002, a sh3 domain of kiaa1010 protein [homo sapiens]
PDB Compounds: (A:) KIAA1010 protein

SCOPe Domain Sequences for d1uhca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uhca1 b.34.2.1 (A:8-73) Hypothetical protein Baa76854.1 (KIAA1010) {Human (Homo sapiens) [TaxId: 9606]}
seaegnqvyfavytfkarnpnelsvsanqklkilefkdvtgntewwlaevngkkgyvpsn
yirkte

SCOPe Domain Coordinates for d1uhca1:

Click to download the PDB-style file with coordinates for d1uhca1.
(The format of our PDB-style files is described here.)

Timeline for d1uhca1: