![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
![]() | Superfamily b.34.2: SH3-domain [50044] (2 families) ![]() |
![]() | Family b.34.2.1: SH3-domain [50045] (40 proteins) |
![]() | Protein Hypothetical protein Baa76854.1 (KIAA1010) [101671] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [101672] (2 PDB entries) |
![]() | Domain d1uhca1: 1uhc A:8-73 [99397] Other proteins in same PDB: d1uhca2, d1uhca3 structural genomics; C-terminal SH3 domain |
PDB Entry: 1uhc (more details)
SCOPe Domain Sequences for d1uhca1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1uhca1 b.34.2.1 (A:8-73) Hypothetical protein Baa76854.1 (KIAA1010) {Human (Homo sapiens) [TaxId: 9606]} seaegnqvyfavytfkarnpnelsvsanqklkilefkdvtgntewwlaevngkkgyvpsn yirkte
Timeline for d1uhca1: