Lineage for d1uh6a1 (1uh6 A:28-100)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. Protein Ubiquitin-like protein 5, ubl5 [102779] (2 species)
  7. Species Mouse (Mus musculus) [TaxId:10090] [102781] (1 PDB entry)
  8. Domain d1uh6a1: 1uh6 A:28-100 [99394]
    Other proteins in same PDB: d1uh6a2

Details for d1uh6a1

PDB Entry: 1uh6 (more details)

PDB Description: Solution Structure of the murine ubiquitin-like 5 protein from RIKEN cDNA 0610031K06
PDB Compounds: (A:) ubiquitin-like 5

SCOPe Domain Sequences for d1uh6a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uh6a1 d.15.1.1 (A:28-100) Ubiquitin-like protein 5, ubl5 {Mouse (Mus musculus) [TaxId: 10090]}
mievvcndrlgkkvrvkcntddtigdlkkliaaqtgtrwnkivlkkwytifkdhvslgdy
eihdgmnlelyyq

SCOPe Domain Coordinates for d1uh6a1 are not available.

Timeline for d1uh6a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1uh6a2