Lineage for d1uh4a2 (1uh4 A:555-637)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 380059Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 380060Superfamily b.71.1: Glycosyl hydrolase domain [51011] (3 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 380061Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (21 proteins)
    this domain follows the catalytic beta/alpha barrel domain
  6. 380261Protein Maltogenic amylase [51031] (4 species)
  7. 380265Species Thermoactinomyces vulgaris, TVAI [TaxId:2026] [75017] (6 PDB entries)
  8. 380268Domain d1uh4a2: 1uh4 A:555-637 [99392]
    Other proteins in same PDB: d1uh4a1, d1uh4a3
    complexed with ca, glc, mpd; mutant

Details for d1uh4a2

PDB Entry: 1uh4 (more details), 1.8 Å

PDB Description: thermoactinomyces vulgaris r-47 alpha-amylase 1/malto-tridecaose complex

SCOP Domain Sequences for d1uh4a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uh4a2 b.71.1.1 (A:555-637) Maltogenic amylase {Thermoactinomyces vulgaris, TVAI}
sfmtlitddtnkiysygrfdnvnriavvlnndsvshtvnvpvwqlsmpngstvtdkitgh
sytvqngmvtvavdghygavlaq

SCOP Domain Coordinates for d1uh4a2:

Click to download the PDB-style file with coordinates for d1uh4a2.
(The format of our PDB-style files is described here.)

Timeline for d1uh4a2: