![]() | Class b: All beta proteins [48724] (141 folds) |
![]() | Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily) folded sheet; greek-key |
![]() | Superfamily b.71.1: Glycosyl hydrolase domain [51011] (3 families) ![]() this domain is C-terminal to the catalytic beta/alpha barrel domain |
![]() | Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (21 proteins) this domain follows the catalytic beta/alpha barrel domain |
![]() | Protein Maltogenic amylase [51031] (4 species) |
![]() | Species Thermoactinomyces vulgaris, TVAI [TaxId:2026] [75017] (6 PDB entries) |
![]() | Domain d1uh4a2: 1uh4 A:555-637 [99392] Other proteins in same PDB: d1uh4a1, d1uh4a3 complexed with ca, glc, mpd; mutant |
PDB Entry: 1uh4 (more details), 1.8 Å
SCOP Domain Sequences for d1uh4a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1uh4a2 b.71.1.1 (A:555-637) Maltogenic amylase {Thermoactinomyces vulgaris, TVAI} sfmtlitddtnkiysygrfdnvnriavvlnndsvshtvnvpvwqlsmpngstvtdkitgh sytvqngmvtvavdghygavlaq
Timeline for d1uh4a2: