Lineage for d1uh4a1 (1uh4 A:1-122)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 362615Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 367734Superfamily b.1.18: E set domains [81296] (18 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 367808Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (16 proteins)
    domains of unknown function associated with different type of catalytic domains in a different sequential location
    subgroup of the larger IPT/TIG domain family
  6. 367925Protein Maltogenic amylase, N-terminal domain N [49221] (4 species)
    precedes the catalytic (beta/alpha)8-barrel domain
  7. 367929Species Thermoactinomyces vulgaris, TVAI [TaxId:2026] [74843] (6 PDB entries)
  8. 367932Domain d1uh4a1: 1uh4 A:1-122 [99391]
    Other proteins in same PDB: d1uh4a2, d1uh4a3
    complexed with ca, glc, mpd; mutant

Details for d1uh4a1

PDB Entry: 1uh4 (more details), 1.8 Å

PDB Description: thermoactinomyces vulgaris r-47 alpha-amylase 1/malto-tridecaose complex

SCOP Domain Sequences for d1uh4a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uh4a1 b.1.18.2 (A:1-122) Maltogenic amylase, N-terminal domain N {Thermoactinomyces vulgaris, TVAI}
aandnnvewnglfhdqgplfdnapeptstqsvtlklrtfkgditsanikywdtadnafhw
vpmvwdsndptgtfdywkgtipaspsikyyrfqindgtstawyngngpsstepnaddfyi
ip

SCOP Domain Coordinates for d1uh4a1:

Click to download the PDB-style file with coordinates for d1uh4a1.
(The format of our PDB-style files is described here.)

Timeline for d1uh4a1: