SCOP 1.71: Domain d1uh3a2: 1uh3 A:555-637

Lineage for d1uh3a2 (1uh3 A:555-637)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (5 families)
   this domain is C-terminal to the catalytic beta/alpha barrel domain

5. Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (21 proteins)
   this domain follows the catalytic beta/alpha barrel domain

6. Protein Maltogenic amylase [51031] (4 species)

7. Species Thermoactinomyces vulgaris, TVAI [TaxId:2026] [75017] (6 PDB entries)

8. Domain d1uh3a2: 1uh3 A:555-637 [99389]
   Other proteins in same PDB: d1uh3a1, d1uh3a3
   complexed with aci, ca, glc, gld

Details for d1uh3a2

PDB Entry: 1uh3, 2.6 Å

PDB Description: thermoactinomyces vulgaris r-47 alpha-amylase/acarbose complex

SCOP Domain Sequences for d1uh3a2:

Sequence; same for both SEQRES and ATOM records:

>d1uh3a2 b.71.1.1 (A:555-637) Maltogenic amylase {Thermoactinomyces vulgaris, TVAI}
sfmtlitddtnkiysygrfdnvnriavvlnndsvshtvnvpvwqlsmpngstvtdkitgh
sytvqngmvtvavdghygavlaq

Timeline for d1uh3a2:

• d1uh3a2 first appeared in SCOP 1.67
  
• d1uh3a2 appears in SCOP 1.69
  
• d1uh3a2 appears in SCOP 1.73
  
• d1uh3a2 appears in the current release, SCOPe 2.08