SCOP 1.71: Domain d1uh2a1: 1uh2 A:1-122

Lineage for d1uh2a1 (1uh2 A:1-122)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (18 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (18 proteins)
   domains of unknown function associated with different type of catalytic domains in a different sequential location
   subgroup of the larger IPT/TIG domain family

6. Protein Maltogenic amylase, N-terminal domain N [49221] (4 species)
   precedes the catalytic (beta/alpha)8-barrel domain

7. Species Thermoactinomyces vulgaris, TVAI [TaxId:2026] [74843] (6 PDB entries)

8. Domain d1uh2a1: 1uh2 A:1-122 [99385]
   Other proteins in same PDB: d1uh2a2, d1uh2a3
   complexed with ca, glc; mutant

Details for d1uh2a1

PDB Entry: 1uh2, 2 Å

PDB Description: thermoactinomyces vulgaris r-47 alpha-amylase/malto-hexaose complex

SCOP Domain Sequences for d1uh2a1:

Sequence; same for both SEQRES and ATOM records:

>d1uh2a1 b.1.18.2 (A:1-122) Maltogenic amylase, N-terminal domain N {Thermoactinomyces vulgaris, TVAI}
aandnnvewnglfhdqgplfdnapeptstqsvtlklrtfkgditsanikywdtadnafhw
vpmvwdsndptgtfdywkgtipaspsikyyrfqindgtstawyngngpsstepnaddfyi
ip

Timeline for d1uh2a1:

• d1uh2a1 first appeared in SCOP 1.67
  
• d1uh2a1 appears in SCOP 1.69
  
• d1uh2a1 appears in SCOP 1.73
  
• d1uh2a1 appears in the current release, SCOPe 2.08