Class b: All beta proteins [48724] (176 folds) |
Fold b.77: beta-Prism I [51091] (3 superfamilies) consists of 3 4-stranded sheets; strands are parallel to the 3-fold axis duplication: has internal pseudo threefold symmetry |
Superfamily b.77.3: Mannose-binding lectins [51101] (2 families) |
Family b.77.3.1: Mannose-binding lectins [51102] (7 proteins) |
Protein Jacalin [51103] (2 species) |
Species Jackfruit (Artocarpus heterophyllus) [TaxId:3489] [51104] (10 PDB entries) |
Domain d1uh1.3: 1uh1 F:,E: [99383] complexed with mgc |
PDB Entry: 1uh1 (more details), 2.8 Å
SCOPe Domain Sequences for d1uh1.3:
Sequence; same for both SEQRES and ATOM records: (download)
>g1uh1.3 b.77.3.1 (F:,E:) Jacalin {Jackfruit (Artocarpus heterophyllus) [TaxId: 3489]} sgksqtvivgpwgakXgkafddgaftgireinlsynketaigdfqvvydlngspyvgqnh ksfitgftpvkisldfpseyimevsgytgnvsgyvvvrsltfktnkktygpygvtsgtpf nlpienglivgfkgsigywldyfsmylsl
Timeline for d1uh1.3: