SCOPe 2.05: Domain d1uh1.3: 1uh1 F:,E:

Lineage for d1uh1.3 (1uh1 F:,E:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.77: beta-Prism I [51091] (3 superfamilies)
   consists of 3 4-stranded sheets; strands are parallel to the 3-fold axis
   duplication: has internal pseudo threefold symmetry

4. Superfamily b.77.3: Mannose-binding lectins [51101] (2 families)

5. Family b.77.3.1: Mannose-binding lectins [51102] (7 proteins)

6. Protein Jacalin [51103] (2 species)

7. Species Jackfruit (Artocarpus heterophyllus) [TaxId:3489] [51104] (10 PDB entries)

8. Domain d1uh1.3: 1uh1 F:,E: [99383]
   complexed with mgc

Details for d1uh1.3

PDB Entry: 1uh1, 2.8 Å

PDB Description: crystal structure of jacalin- galnac-beta(1-3)-gal-alpha-o-me complex

PDB Compounds: (E:) agglutinin alpha chain, (F:) Agglutinin beta-3 chain

SCOPe Domain Sequences for d1uh1.3:

Sequence; same for both SEQRES and ATOM records:

>g1uh1.3 b.77.3.1 (F:,E:) Jacalin {Jackfruit (Artocarpus heterophyllus) [TaxId: 3489]}
sgksqtvivgpwgakXgkafddgaftgireinlsynketaigdfqvvydlngspyvgqnh
ksfitgftpvkisldfpseyimevsgytgnvsgyvvvrsltfktnkktygpygvtsgtpf
nlpienglivgfkgsigywldyfsmylsl

Timeline for d1uh1.3:

• d1uh1.3 first appeared in SCOP 1.67
  
• d1uh1.3 appears in SCOPe 2.04
  
• d1uh1.3 appears in SCOPe 2.06
  
• d1uh1.3 appears in the current release, SCOPe 2.08