Lineage for d1uh1.3 (1uh1 F:,E:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2813105Fold b.77: beta-Prism I [51091] (4 superfamilies)
    consists of 3 4-stranded sheets; strands are parallel to the 3-fold axis
    duplication: has internal pseudo threefold symmetry
  4. 2813155Superfamily b.77.3: Mannose-binding lectins [51101] (2 families) (S)
  5. 2813156Family b.77.3.1: Mannose-binding lectins [51102] (7 proteins)
  6. 2813220Protein Jacalin [51103] (2 species)
  7. 2813230Species Jackfruit (Artocarpus heterophyllus) [TaxId:3489] [51104] (10 PDB entries)
  8. 2813263Domain d1uh1.3: 1uh1 F:,E: [99383]
    complexed with mgc

Details for d1uh1.3

PDB Entry: 1uh1 (more details), 2.8 Å

PDB Description: crystal structure of jacalin- galnac-beta(1-3)-gal-alpha-o-me complex
PDB Compounds: (E:) agglutinin alpha chain, (F:) Agglutinin beta-3 chain

SCOPe Domain Sequences for d1uh1.3:

Sequence; same for both SEQRES and ATOM records: (download)

>g1uh1.3 b.77.3.1 (F:,E:) Jacalin {Jackfruit (Artocarpus heterophyllus) [TaxId: 3489]}
sgksqtvivgpwgakXgkafddgaftgireinlsynketaigdfqvvydlngspyvgqnh
ksfitgftpvkisldfpseyimevsgytgnvsgyvvvrsltfktnkktygpygvtsgtpf
nlpienglivgfkgsigywldyfsmylsl

SCOPe Domain Coordinates for d1uh1.3:

Click to download the PDB-style file with coordinates for d1uh1.3.
(The format of our PDB-style files is described here.)

Timeline for d1uh1.3: