SCOP 1.67: Domain d1uh0.1: 1uh0 B:,A:

Lineage for d1uh0.1 (1uh0 B:,A:)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.77: beta-Prism I [51091] (3 superfamilies)
   consists of 3 4-stranded sheets; strands are parallel to the 3-fold axis
   duplication: has internal pseudo threefold symmetry

4. Superfamily b.77.3: Mannose-binding lectins [51101] (1 family)

5. Family b.77.3.1: Mannose-binding lectins [51102] (5 proteins)

6. Protein Jacalin [51103] (1 species)

7. Species Jackfruit (Artocarpus integrifolia) [51104] (10 PDB entries)

8. Domain d1uh0.1: 1uh0 B:,A: [99377]

Details for d1uh0.1

PDB Entry: 1uh0, 2.8 Å

PDB Description: crystal structure of jacalin- me-alpha-galnac complex

SCOP Domain Sequences for d1uh0.1:

Sequence; same for both SEQRES and ATOM records:

>g1uh0.1 b.77.3.1 (B:,A:) Jacalin {Jackfruit (Artocarpus integrifolia)}
sgksqtvivgpwgakXgkafddgaftgireinlsynketaigdfqvvydlngspyvgqnh
ksfitgftpvkisldfpseyimevsgytgnvsgyvvvrsltfktnkktygpygvtsgtpf
nlpienglivgfkgsigywldyfsmylsl

Timeline for d1uh0.1:

• d1uh0.1 is new in SCOP 1.67
  
• d1uh0.1 appears in SCOP 1.69
  
• d1uh0.1 appears in the current release, SCOPe 2.08