SCOPe 2.06: Domain d1ugy.2: 1ugy D:,C:

Lineage for d1ugy.2 (1ugy D:,C:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.77: beta-Prism I [51091] (3 superfamilies)
   consists of 3 4-stranded sheets; strands are parallel to the 3-fold axis
   duplication: has internal pseudo threefold symmetry

4. Superfamily b.77.3: Mannose-binding lectins [51101] (2 families)

5. Family b.77.3.1: Mannose-binding lectins [51102] (7 proteins)

6. Protein Jacalin [51103] (2 species)

7. Species Jackfruit (Artocarpus heterophyllus) [TaxId:3489] [51104] (10 PDB entries)

8. Domain d1ugy.2: 1ugy D:,C: [99374]

Details for d1ugy.2

PDB Entry: 1ugy, 2.4 Å

PDB Description: crystal structure of jacalin- mellibiose (gal-alpha(1-6)-glc) complex

PDB Compounds: (C:) agglutinin alpha chain, (D:) Agglutinin beta-3 chain

SCOPe Domain Sequences for d1ugy.2:

Sequence; same for both SEQRES and ATOM records:

>g1ugy.2 b.77.3.1 (D:,C:) Jacalin {Jackfruit (Artocarpus heterophyllus) [TaxId: 3489]}
qsgisqtvivgpwgakXgkafddgaftgireinlsynketaigdfqvvydlngspyvgqn
hksfitgftpvkisldfpseyimevsgytgnvsgyvvvrsltfktnkktygpygvtsgtp
fnlpienglivgfkgsigywldyfsmylsl

Timeline for d1ugy.2:

• d1ugy.2 first appeared in SCOP 1.67
  
• d1ugy.2 appears in SCOPe 2.05
  
• d1ugy.2 appears in SCOPe 2.07
  
• d1ugy.2 appears in the current release, SCOPe 2.08