Lineage for d1ugx.1 (1ugx B:,A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2079052Fold b.77: beta-Prism I [51091] (3 superfamilies)
    consists of 3 4-stranded sheets; strands are parallel to the 3-fold axis
    duplication: has internal pseudo threefold symmetry
  4. 2079092Superfamily b.77.3: Mannose-binding lectins [51101] (2 families) (S)
  5. 2079093Family b.77.3.1: Mannose-binding lectins [51102] (7 proteins)
  6. 2079157Protein Jacalin [51103] (2 species)
  7. 2079167Species Jackfruit (Artocarpus heterophyllus) [TaxId:3489] [51104] (10 PDB entries)
  8. 2079168Domain d1ugx.1: 1ugx B:,A: [99372]

Details for d1ugx.1

PDB Entry: 1ugx (more details), 1.6 Å

PDB Description: crystal structure of jacalin- me-alpha-t-antigen (gal-beta(1-3)- galnac-alpha-o-me) complex
PDB Compounds: (A:) agglutinin alpha chain, (B:) Agglutinin beta-3 chain

SCOPe Domain Sequences for d1ugx.1:

Sequence; same for both SEQRES and ATOM records: (download)

>g1ugx.1 b.77.3.1 (B:,A:) Jacalin {Jackfruit (Artocarpus heterophyllus) [TaxId: 3489]}
sgisqtvivgpwgakXgkafddgaftgireinlsynketaigdfqvvydlngspyvgqnh
vsfitgftpvkisldfpseyimevsgytgnvsgyvvvrsltfktnkktygpygvtsgtpf
nlpienglivgfkgsigywldyfsmylsl

SCOPe Domain Coordinates for d1ugx.1:

Click to download the PDB-style file with coordinates for d1ugx.1.
(The format of our PDB-style files is described here.)

Timeline for d1ugx.1: