SCOP 1.71: Domain d1ugw.4: 1ugw H:,G:

Lineage for d1ugw.4 (1ugw H:,G:)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.77: beta-Prism I [51091] (3 superfamilies)
   consists of 3 4-stranded sheets; strands are parallel to the 3-fold axis
   duplication: has internal pseudo threefold symmetry

4. Superfamily b.77.3: Mannose-binding lectins [51101] (1 family)

5. Family b.77.3.1: Mannose-binding lectins [51102] (5 proteins)

6. Protein Jacalin [51103] (2 species)

7. Species Jackfruit (Artocarpus integrifolia) [51104] (10 PDB entries)

8. Domain d1ugw.4: 1ugw H:,G: [99371]
   complexed with gal

Details for d1ugw.4

PDB Entry: 1ugw, 1.7 Å

PDB Description: crystal structure of jacalin- gal complex

SCOP Domain Sequences for d1ugw.4:

Sequence; same for both SEQRES and ATOM records:

>g1ugw.4 b.77.3.1 (H:,G:) Jacalin {Jackfruit (Artocarpus integrifolia)}
qsgisqtvivgpwgakXgkafddgaftgireinlsynketaigdfqvvydlngspyvgqn
hvsfitgftpvkisldfpseyimevsgytgnvsgyvvvrsltfktnkktygpygvtsgtp
fnlpienglivgfkgsigywldyfsmylsl

Timeline for d1ugw.4:

• d1ugw.4 first appeared in SCOP 1.67
  
• d1ugw.4 appears in SCOP 1.69
  
• d1ugw.4 appears in SCOP 1.73
  
• d1ugw.4 appears in the current release, SCOPe 2.08