SCOPe 2.06: Domain d1ugw.3: 1ugw F:,E:

Lineage for d1ugw.3 (1ugw F:,E:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.77: beta-Prism I [51091] (3 superfamilies)
   consists of 3 4-stranded sheets; strands are parallel to the 3-fold axis
   duplication: has internal pseudo threefold symmetry

4. Superfamily b.77.3: Mannose-binding lectins [51101] (2 families)

5. Family b.77.3.1: Mannose-binding lectins [51102] (7 proteins)

6. Protein Jacalin [51103] (2 species)

7. Species Jackfruit (Artocarpus heterophyllus) [TaxId:3489] [51104] (10 PDB entries)

8. Domain d1ugw.3: 1ugw F:,E: [99370]
   complexed with gal

Details for d1ugw.3

PDB Entry: 1ugw, 1.7 Å

PDB Description: crystal structure of jacalin- gal complex

PDB Compounds: (E:) Agglutinin alpha-chain, (F:) Agglutinin beta-3 chain

SCOPe Domain Sequences for d1ugw.3:

Sequence; same for both SEQRES and ATOM records:

>g1ugw.3 b.77.3.1 (F:,E:) Jacalin {Jackfruit (Artocarpus heterophyllus) [TaxId: 3489]}
qsgisqtvivgpwgakssXgkafddgaftgireinlsynketaigdfqvvydlngspyvg
qnhksfitgftpvkisldfpseyimevsgytgnvsgyvvvrsltfktnkktygpygvtsg
tpfnlpienglivgfkgsigywldyfsmylsl

Timeline for d1ugw.3:

• d1ugw.3 first appeared in SCOP 1.67
  
• d1ugw.3 appears in SCOPe 2.05
  
• d1ugw.3 appears in SCOPe 2.07
  
• d1ugw.3 appears in the current release, SCOPe 2.08