SCOPe 2.08: Domain d1ugw.2: 1ugw D:,C:

Lineage for d1ugw.2 (1ugw D:,C:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.77: beta-Prism I [51091] (4 superfamilies)
   consists of 3 4-stranded sheets; strands are parallel to the 3-fold axis
   duplication: has internal pseudo threefold symmetry

4. Superfamily b.77.3: Mannose-binding lectins [51101] (2 families)

5. Family b.77.3.1: Mannose-binding lectins [51102] (7 proteins)

6. Protein Jacalin [51103] (2 species)

7. Species Jackfruit (Artocarpus heterophyllus) [TaxId:3489] [51104] (10 PDB entries)

8. Domain d1ugw.2: 1ugw D:,C: [99369]
   complexed with gal

Details for d1ugw.2

PDB Entry: 1ugw, 1.7 Å

PDB Description: crystal structure of jacalin- gal complex

PDB Compounds: (C:) Agglutinin alpha-chain, (D:) Agglutinin beta-3 chain

SCOPe Domain Sequences for d1ugw.2:

Sequence; same for both SEQRES and ATOM records:

>g1ugw.2 b.77.3.1 (D:,C:) Jacalin {Jackfruit (Artocarpus heterophyllus) [TaxId: 3489]}
qsgisqtvivgpwgakXgkafddgaftgireinlsynketaigdfqvvydlngspyvgqn
hksfitgftpvkisldfpseyimevsgytgnvsgyvvvrsltfktnkktygpygvtsgtp
fnlpienglivgfkgsigywldyfsmylsl

Timeline for d1ugw.2:

• d1ugw.2 first appeared in SCOP 1.67
  
• d1ugw.2 appears in SCOPe 2.07