Class b: All beta proteins [48724] (177 folds) |
Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.2: SH3-domain [50044] (2 families) |
Family b.34.2.1: SH3-domain [50045] (40 proteins) |
Protein Olygophrenin-1 like protein (KIAA0621) [101673] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [101674] (1 PDB entry) |
Domain d1ugva1: 1ugv A:8-66 [99367] Other proteins in same PDB: d1ugva2, d1ugva3 structural genomics |
PDB Entry: 1ugv (more details)
SCOPe Domain Sequences for d1ugva1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ugva1 b.34.2.1 (A:8-66) Olygophrenin-1 like protein (KIAA0621) {Human (Homo sapiens) [TaxId: 9606]} tpfrkakalyackaehdselsftagtvfdnvhpsqepgwlegtlngktglipenyvefl
Timeline for d1ugva1: