| Class b: All beta proteins [48724] (176 folds) |
| Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.2: SH3-domain [50044] (2 families) ![]() |
| Family b.34.2.1: SH3-domain [50045] (40 proteins) |
| Protein Olygophrenin-1 like protein (KIAA0621) [101673] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [101674] (1 PDB entry) |
| Domain d1ugva_: 1ugv A: [99367] structural genomics |
PDB Entry: 1ugv (more details)
SCOPe Domain Sequences for d1ugva_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ugva_ b.34.2.1 (A:) Olygophrenin-1 like protein (KIAA0621) {Human (Homo sapiens) [TaxId: 9606]}
gssgssgtpfrkakalyackaehdselsftagtvfdnvhpsqepgwlegtlngktglipe
nyveflsgpssg
Timeline for d1ugva_: