Lineage for d1ugva1 (1ugv A:8-66)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2782861Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 2782862Family b.34.2.1: SH3-domain [50045] (40 proteins)
  6. 2783154Protein Olygophrenin-1 like protein (KIAA0621) [101673] (1 species)
  7. 2783155Species Human (Homo sapiens) [TaxId:9606] [101674] (1 PDB entry)
  8. 2783156Domain d1ugva1: 1ugv A:8-66 [99367]
    Other proteins in same PDB: d1ugva2, d1ugva3
    structural genomics

Details for d1ugva1

PDB Entry: 1ugv (more details)

PDB Description: solution structure of the sh3 domain of human olygophrein-1 like protein (kiaa0621)
PDB Compounds: (A:) Olygophrenin-1 like protein

SCOPe Domain Sequences for d1ugva1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ugva1 b.34.2.1 (A:8-66) Olygophrenin-1 like protein (KIAA0621) {Human (Homo sapiens) [TaxId: 9606]}
tpfrkakalyackaehdselsftagtvfdnvhpsqepgwlegtlngktglipenyvefl

SCOPe Domain Coordinates for d1ugva1:

Click to download the PDB-style file with coordinates for d1ugva1.
(The format of our PDB-style files is described here.)

Timeline for d1ugva1: