Lineage for d1ugla_ (1ugl A:)

  1. Root: SCOPe 2.06
  2. 2256768Class g: Small proteins [56992] (94 folds)
  3. 2257050Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 2257552Superfamily g.3.7: Scorpion toxin-like [57095] (6 families) (S)
  5. 2257847Family g.3.7.5: Plant defensins [57170] (9 proteins)
  6. 2257894Protein S-locus pollen protein [103559] (1 species)
  7. 2257895Species Turnip (Brassica rapa) [TaxId:3711] [103560] (1 PDB entry)
  8. 2257896Domain d1ugla_: 1ugl A: [99366]

Details for d1ugla_

PDB Entry: 1ugl (more details)

PDB Description: solution structure of s8-sp11
PDB Compounds: (A:) S-locus pollen protein

SCOPe Domain Sequences for d1ugla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ugla_ g.3.7.5 (A:) S-locus pollen protein {Turnip (Brassica rapa) [TaxId: 3711]}
nlmkrctrgfrklgkcttleeekcktlyprgqctcsdskmnthscdcksc

SCOPe Domain Coordinates for d1ugla_:

Click to download the PDB-style file with coordinates for d1ugla_.
(The format of our PDB-style files is described here.)

Timeline for d1ugla_: