Class g: Small proteins [56992] (94 folds) |
Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
Superfamily g.3.7: Scorpion toxin-like [57095] (6 families) |
Family g.3.7.5: Plant defensins [57170] (9 proteins) |
Protein S-locus pollen protein [103559] (1 species) |
Species Turnip (Brassica rapa) [TaxId:3711] [103560] (1 PDB entry) |
Domain d1ugla_: 1ugl A: [99366] |
PDB Entry: 1ugl (more details)
SCOPe Domain Sequences for d1ugla_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ugla_ g.3.7.5 (A:) S-locus pollen protein {Turnip (Brassica rapa) [TaxId: 3711]} nlmkrctrgfrklgkcttleeekcktlyprgqctcsdskmnthscdcksc
Timeline for d1ugla_: