Lineage for d1ugka1 (1ugk A:8-132)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2382505Fold b.7: C2 domain-like [49561] (5 superfamilies)
    sandwich; 8 strands in 2 sheets; greek-key
  4. 2382506Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (3 families) (S)
    two constituent families are related by circular permutation
  5. 2382667Family b.7.1.2: Synaptotagmin-like (S variant) [49575] (11 proteins)
    topologically similar to the C-terminal domain of PapD
  6. 2382742Protein Synaptotagmin IV [101562] (2 species)
    duplication: contains 2 C2 domains
  7. 2382743Species Human (Homo sapiens) [TaxId:9606] [101563] (1 PDB entry)
  8. 2382744Domain d1ugka1: 1ugk A:8-132 [99365]
    Other proteins in same PDB: d1ugka2, d1ugka3

Details for d1ugka1

PDB Entry: 1ugk (more details)

PDB Description: solution structure of the first c2 domain of synaptotagmin iv from human fetal brain (kiaa1342)
PDB Compounds: (A:) Synaptotagmin IV

SCOPe Domain Sequences for d1ugka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ugka1 b.7.1.2 (A:8-132) Synaptotagmin IV {Human (Homo sapiens) [TaxId: 9606]}
lgtlffsleynferkafvvnikearglpamdeqsmtsdpyikmtilpekkhkvktrvlrk
tldpafdetftfygipytqiqelalhftilsfdrfsrddiigevliplsgielsegkmlm
nreii

SCOPe Domain Coordinates for d1ugka1:

Click to download the PDB-style file with coordinates for d1ugka1.
(The format of our PDB-style files is described here.)

Timeline for d1ugka1: