Lineage for d1ugka_ (1ugk A:)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 792147Fold b.7: C2 domain-like [49561] (5 superfamilies)
    sandwich; 8 strands in 2 sheets; greek-key
  4. 792148Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (2 families) (S)
    two constituent families are related by circular permutation
  5. 792220Family b.7.1.2: Synaptotagmin-like (S variant) [49575] (10 proteins)
    topologically similar to the C-terminal domain of PapD
  6. 792260Protein Synaptotagmin IV [101562] (2 species)
    duplication: contains 2 C2 domains
  7. 792261Species Human (Homo sapiens) [TaxId:9606] [101563] (1 PDB entry)
  8. 792262Domain d1ugka_: 1ugk A: [99365]

Details for d1ugka_

PDB Entry: 1ugk (more details)

PDB Description: solution structure of the first c2 domain of synaptotagmin iv from human fetal brain (kiaa1342)
PDB Compounds: (A:) Synaptotagmin IV

SCOP Domain Sequences for d1ugka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ugka_ b.7.1.2 (A:) Synaptotagmin IV {Human (Homo sapiens) [TaxId: 9606]}
gssgssglgtlffsleynferkafvvnikearglpamdeqsmtsdpyikmtilpekkhkv
ktrvlrktldpafdetftfygipytqiqelalhftilsfdrfsrddiigevliplsgiel
segkmlmnreiisgpssg

SCOP Domain Coordinates for d1ugka_:

Click to download the PDB-style file with coordinates for d1ugka_.
(The format of our PDB-style files is described here.)

Timeline for d1ugka_: