![]() | Class b: All beta proteins [48724] (165 folds) |
![]() | Fold b.7: C2 domain-like [49561] (4 superfamilies) sandwich; 8 strands in 2 sheets; greek-key |
![]() | Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (2 families) ![]() two constituent families are related by circular permutation |
![]() | Family b.7.1.2: Synaptotagmin-like (S variant) [49575] (10 proteins) topologically similar to the C-terminal domain of PapD |
![]() | Protein Synaptotagmin IV [101562] (2 species) duplication: contains 2 C2 domains |
![]() | Species Human (Homo sapiens) [TaxId:9606] [101563] (1 PDB entry) |
![]() | Domain d1ugka_: 1ugk A: [99365] |
PDB Entry: 1ugk (more details)
SCOP Domain Sequences for d1ugka_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ugka_ b.7.1.2 (A:) Synaptotagmin IV {Human (Homo sapiens) [TaxId: 9606]} gssgssglgtlffsleynferkafvvnikearglpamdeqsmtsdpyikmtilpekkhkv ktrvlrktldpafdetftfygipytqiqelalhftilsfdrfsrddiigevliplsgiel segkmlmnreiisgpssg
Timeline for d1ugka_: