Lineage for d1ug9a4 (1ug9 A:2-273)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2781474Fold b.30: Supersandwich [49993] (3 superfamilies)
    sandwich; 18 strands in 2 sheets
  4. 2781620Superfamily b.30.5: Galactose mutarotase-like [74650] (12 families) (S)
    probable carbohydrate-binding domain in enzymes acting on sugars
  5. 2781958Family b.30.5.5: Bacterial glucoamylase N-terminal domain-like [82042] (2 proteins)
    overall domain organization is similar to Lactobacillus maltose phosphorylase
    automatically mapped to Pfam PF09137
  6. 2781965Protein Glucodextranase, domain N [101661] (1 species)
  7. 2781966Species Arthrobacter globiformis [TaxId:1665] [101662] (2 PDB entries)
  8. 2781967Domain d1ug9a4: 1ug9 A:2-273 [99364]
    Other proteins in same PDB: d1ug9a1, d1ug9a2, d1ug9a3
    complexed with ca, gol

Details for d1ug9a4

PDB Entry: 1ug9 (more details), 2.5 Å

PDB Description: Crystal Structure of Glucodextranase from Arthrobacter globiformis I42
PDB Compounds: (A:) glucodextranase

SCOPe Domain Sequences for d1ug9a4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ug9a4 b.30.5.5 (A:2-273) Glucodextranase, domain N {Arthrobacter globiformis [TaxId: 1665]}
taeppgspgaaatwtkgdkegvgtslnpaskvwytltegtmsevyyphadtpntrelqfa
vsdgtsaqreseqttrtveladpkalsyrqtttdnagrwrltktyvtdprrstvmlgvtf
evldggdyqlfvlsdpslagtsggdtgsvtdgallasdladaatpvatalvssvgfgava
ngyvgtsdgwtdlaadgrldnasatagpgnisqtgqiplaaggktefslalgfgadtaea
latakaslgtgykkvsksytgewkkylnslda

SCOPe Domain Coordinates for d1ug9a4:

Click to download the PDB-style file with coordinates for d1ug9a4.
(The format of our PDB-style files is described here.)

Timeline for d1ug9a4: